Trichomycterus rosablanca: 134329435 Help Entry 134329435         CDS       T09921                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism trn  Trichomycterus rosablanca Brite KEGG Orthology (KO) [BR:trn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:trn03041]     134329435 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:trn04052]     134329435 (ubl5) Spliceosome [BR:trn03041]  Complex B   Other components    Complex B specific factors     134329435 (ubl5) Cytokines and neuropeptides [BR:trn04052]  Neuropeptides   Unclassified    134329435 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  134329435 NCBI-ProteinID:  XP_062866768 LinkDB All DBs Position 15:complement(33449716..33459249) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNGDDTIGDLKKLIAAQTGTKWDKIVLKKWYTIFKDHVSLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgtgtaacgaccggctgggcaagaaggtccgagtcaagtgcaatggc gacgacaccatcggggatctgaagaagctgatcgccgcccagaccggaaccaagtgggac aagatcgtcctgaagaaatggtacaccatatttaaggaccacgtctcactgagcgactat gagatccatgatgggatgaacctggagctgtattaccagtag

DBGET integrated database retrieval system