Trichomycterus rosablanca: 134330221 Help Entry 134330221         CDS       T09921                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism trn  Trichomycterus rosablanca Pathway trn04517   IgSF CAM signaling trn04814   Motor proteins trn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     134330221 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     134330221 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134330221 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:trn03037]     134330221 (dynll2b)    04812 Cytoskeleton proteins [BR:trn04812]     134330221 (dynll2b) Cilium and associated proteins [BR:trn03037]  Motile cilia and associated proteins   Dynein arm    134330221 (dynll2b) Cytoskeleton proteins [BR:trn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      134330221 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  134330221 NCBI-ProteinID:  XP_062867323 LinkDB All DBs Position 16:19596836..19600508 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaggcagtgataaagaatgctgatatgtctgaagacatgcagcaggat gctgtggactgtgccacacaggccatggagaagtacaatatagagaaagacattgctgcc tacatcaaaaaggagtttgataagaagtacaacccgacatggcattgcattgtgggacga aactttggcagctatgtgactcatgaaacaaagcacttcatctacttctaccttggtcaa gtggccattctgcttttcaagtcaggctga

DBGET integrated database retrieval system