Trichomycterus rosablanca: 134331367 Help Entry 134331367         CDS       T09921                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism trn  Trichomycterus rosablanca Pathway trn04010   MAPK signaling pathway trn04137   Mitophagy - animal trn04140   Autophagy - animal trn04218   Cellular senescence trn04371   Apelin signaling pathway trn04625   C-type lectin receptor signaling pathway trn04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134331367 (rras2)    04371 Apelin signaling pathway     134331367 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134331367 (rras2)    04137 Mitophagy - animal     134331367 (rras2)   09143 Cell growth and death    04218 Cellular senescence     134331367 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134331367 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134331367 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:trn04147]     134331367 (rras2)    04031 GTP-binding proteins [BR:trn04031]     134331367 (rras2) Exosome [BR:trn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    134331367 (rras2)   Exosomal proteins of bladder cancer cells    134331367 (rras2) GTP-binding proteins [BR:trn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134331367 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  134331367 NCBI-ProteinID:  XP_062868813 LinkDB All DBs Position 17:complement(18244673..18340857) Genome browser AA seq 202 aa AA seqDB search MAGWKDGAVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVSQDEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTHKEKDKRGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggcgcggtgcaggagaagtatcggctcgtcgtggtcggaggc ggcggggttggaaaatccgctttaaccattcagttcattcagtcttacttcgtcaccgac tatgatcccacgatcgaagactcctacacgaagcagtgtgtgatcgacgagagagcagct cggcttgacattctggacacggccgggcaggaagagtttggggccatgagagaacaatac atgaggacaggggagggcttcctacttgtcttctctgtcacagaccggggcagctttgag gagatctacaaattccaaagacagatcctgagagtgaaggaccgggacgagtttccaatg atccttgtgggcaataaggccgatctagagctccagagacaggtgtctcaagacgagggt cagcagctcgctagacagctcaaagtcacgtacatggaggcttcagctaaaatccgtatg aatgtagaccaggccttccatgagctcgtccgtgtcatcagaaagttccaggagcaagag tgcccaccatcaccagagcccacacataaagagaaggacaagaggggctgccactgcgtg attttctga

DBGET integrated database retrieval system