Thermomicrobium roseum: trd_0679 Help Entry trd_0679          CDS       T00845                                  Name (GenBank) preprotein translocase   KO K03073   preprotein translocase subunit SecE Organism tro  Thermomicrobium roseum Pathway tro02024   Quorum sensing tro03060   Protein export tro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     trd_0679  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     trd_0679  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     trd_0679  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tro02044]     trd_0679 Secretion system [BR:tro02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    trd_0679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE DUF8100 Motif Other DBs NCBI-ProteinID:  ACM04579 UniProt:  B9KYX1 LinkDB All DBs Position 672611..672880 Genome browser AA seq 89 aa AA seqDB search MTTKTQSPARAASKAKPQERPAKSKSGRLVALRRLIADLRSEWRKITWPDRETTRKLTLL VIGLATVLGLILGAVDAIFVRLWNLLGGL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacaacgaagacgcagagtccggcgcgggcggcgagcaaagcgaagccacaggagcgt ccggcgaaaagcaagtccgggcggctcgtcgcgctccgtcgcttgatcgctgatctgcgg tcggaatggcgcaagatcacctggccggatcgcgagacgacccgcaagctgacgctgctg gtcatcggattggccaccgttctcggtctgatcctcggtgcagtcgatgccatcttcgta cgactctggaatcttctcggagggctgtga

DBGET integrated database retrieval system