Thermomicrobium roseum: trd_0783 Help Entry trd_0783          CDS       T00845                                  Name (GenBank) mttA/Hcf106 family   KO K03116   sec-independent protein translocase protein TatA Organism tro  Thermomicrobium roseum Pathway tro03060   Protein export tro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     trd_0783  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     trd_0783  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tro02044]     trd_0783 Secretion system [BR:tro02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    trd_0783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF7807 Motif Other DBs NCBI-ProteinID:  ACM04809 UniProt:  B9KZ70 LinkDB All DBs Position 770990..771178 Genome browser AA seq 62 aa AA seqDB search MYPLLLPSFGWQELLLVLLIVLVVFGAGRLPEIGSAIGRTIREFRTATREATAEVSGDEP RS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt gtgtatccgcttttgctcccctcattcggctggcaggaattgctgctcgtcctgctgatc gtgctcgtcgttttcggcgccggtcggctaccggagatcggtagtgccatcggacgcacg atccgagagttccgaaccgcgacgcgcgaagcgactgccgaggtttcgggagacgagccg cgttcgtga

DBGET integrated database retrieval system