KEGG   Thermomicrobium roseum: trd_0881
Entry
trd_0881          CDS       T00845                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
tro  Thermomicrobium roseum
Pathway
tro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tro00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    trd_0881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tro02000]
    trd_0881
Transporters [BR:tro02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    trd_0881
SSDB
Motif
Pfam: ABC_tran TOBE_2 SMC_N OB_MalK T2SSE AAA_25 AAA_29 DUF5818 AAA_22 nSTAND3 SRP54 AAA_19
Other DBs
NCBI-ProteinID: ACM05577
UniProt: B9KZG1
LinkDB
Position
complement(862582..863715)
AA seq 377 aa
MDGDVMATVKTMPASGPEAGLGARLQLIELTKVYGDVVAADRVTLDIAPGEFITLLGPSG
SGKTTTLMMVAGFVIPTSGQILVNGEDIAFRPPHKRNIGMVFQNYALFPHMTVAENIAFP
LKMRKWPRDRIEQAVREALQLVRLPGFEQRYPRQLSGGQQQRVALARALVFRPPVLLMDE
PLGALDKKLREEMQLEIKHIQESLNITTIYVTHDQEEALTMSDRIAVMRDGRIEQIGTPR
ELYEQPASEFVASFIGESNFLMGRLERRDGHAYLVTEDGWRVAIPDAEDLPAGEQVTVAL
RPERIVLGERRGENHAEATIEEIIYVGEATKFRVRLLGDRLLTVKQPSRLETMRWQRGER
VLLSWRAEDAVLLRGRH
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtggatggtgacgtgatggcgacggtcaagacgatgcccgcttcgggcccggaagctggt
ctcggggcgcggctccagctgatcgaactcacgaaggtctacggggacgtcgttgcggct
gatcgagtcactctggacatcgctcccggtgagttcattaccttgctcggtccatcggga
tccgggaagacaacgacgctcatgatggtcgctggattcgtcattcccacgtccggccag
atcctcgtcaacggtgaagatattgcattccgaccaccccacaagcgcaatatcggtatg
gttttccaaaattatgcactctttcctcatatgaccgtcgctgagaatattgcgttccca
ttgaagatgcgaaaatggccgcgtgatcgtatcgaacaggcagtgagagaggcgttgcaa
ctggtgcgcctacctggctttgagcagcgctatcctcggcaactttccggcggtcagcag
cagcgtgtagccctcgcgcgggctttggtctttcgtccacctgttttgctcatggacgag
cctttgggggcgctggacaagaaacttcgtgaagagatgcaactggaaatcaagcatatt
caagaatcactgaatatcaccacgatctatgtcacccatgaccaggaagaagcgttgacg
atgtccgatcgtatcgccgtcatgcgtgatgggcgtatcgagcagatcggtacgccgcgc
gagttgtacgagcagccggccagcgagttcgtggccagcttcatcggggaatcgaacttt
ctcatggggcgactggagcgacgtgatgggcatgcttaccttgtcaccgaagacggctgg
agagtagcgatccccgatgcagaggatctgcctgccggcgagcaagtgacagttgctttg
cgaccagagcgaatcgtgctcggggagcggcgtggtgagaaccacgccgaggcgaccatc
gaggagatcatttacgtgggcgaagcgaccaaattccgcgttcgtcttctcggcgatcgg
cttttgacggtgaagcagcctagcaggttggagacgatgcgctggcagcgcggggaacgg
gtcctcctcagctggcgagccgaggatgcggtcctcctacggggacgacattga

DBGET integrated database retrieval system