Thermomicrobium roseum: trd_1618 Help Entry trd_1618          CDS       T00845                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tro  Thermomicrobium roseum Pathway tro01100   Metabolic pathways tro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     trd_1618 (acpP)    00074 Mycolic acid biosynthesis     trd_1618 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     trd_1618 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 PRD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACM06096 UniProt:  B9L0C5 LinkDB All DBs Position complement(1613336..1613581) Genome browser AA seq 81 aa AA seqDB search MSSSILERVQAVVAEQLGVDPSEVTPDAEFVKDLNADSLDLVELIMQLEEEFGIEISDEE AANIVTVRDAINFIEEHLGKQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtgtcgtcgtcgattttggagcgggtgcaggccgtcgtggccgagcagctcggtgtcgat ccgagcgaggtgactccggatgccgagttcgtcaaggatctcaatgctgattcgctggac ctcgtcgagctgatcatgcagctcgaagaagagttcggcatcgagatctcggacgaagag gcagccaacatcgtcaccgtgcgtgatgcgatcaacttcatcgaggagcacctcggcaag caatga

DBGET integrated database retrieval system