Thermomicrobium roseum: trd_1904 Help Entry trd_1904          CDS       T00845                                  Name (GenBank) mttA/Hcf106 family protein   KO K03116   sec-independent protein translocase protein TatA Organism tro  Thermomicrobium roseum Pathway tro03060   Protein export tro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     trd_1904  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     trd_1904  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tro02044]     trd_1904 Secretion system [BR:tro02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    trd_1904 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E HTH_15 Motif Other DBs NCBI-ProteinID:  ACM05022 UniProt:  B9L204 LinkDB All DBs Position 1912113..1912367 Genome browser AA seq 84 aa AA seqDB search MIDGLRQPWRLRSSLLIVLIDFGPGKLSELGSAIGRSIREFRRNVRDETSGQRAAERART PETAFLRWTLARLRRVPGFRVPGY NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatcgacggtttgcggcaaccctggcggttgcgcagcagtttgctcatcgtcctgatc gactttggacctgggaagctttctgagctgggatcggcgatcggacggagtatccgcgag ttccgtcggaatgtgcgggacgagacgtcgggtcagcgagccgctgagagagcgcgcact cccgagacggcgttcttgcgttggacactggctcgcctccgacgtgttccggggttccga gttcccggttactga

DBGET integrated database retrieval system