Triplophysa rosa: 130545652 Help Entry 130545652         CDS       T09216                                  Symbol zgc:100918 Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism tros  Triplophysa rosa Pathway tros04137   Mitophagy - animal tros04140   Autophagy - animal tros04144   Endocytosis tros04145   Phagosome tros04148   Efferocytosis tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130545652 (zgc:100918)    04145 Phagosome     130545652 (zgc:100918)    04140 Autophagy - animal     130545652 (zgc:100918)    04137 Mitophagy - animal     130545652 (zgc:100918)    04148 Efferocytosis     130545652 (zgc:100918)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130545652 (zgc:100918)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tros04131]     130545652 (zgc:100918)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tros04147]     130545652 (zgc:100918)    04031 GTP-binding proteins [BR:tros04031]     130545652 (zgc:100918) Membrane trafficking [BR:tros04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130545652 (zgc:100918) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130545652 (zgc:100918)   Exosomal proteins of other body fluids (saliva and urine)    130545652 (zgc:100918)   Exosomal proteins of colorectal cancer cells    130545652 (zgc:100918)   Exosomal proteins of bladder cancer cells    130545652 (zgc:100918) GTP-binding proteins [BR:tros04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130545652 (zgc:100918) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 nSTAND3 PduV-EutP Septin AAA_16 AAA_22 NTPase_1 AAA_7 AAA_24 G-alpha SRPRB AAA_5 DUF5992 ATPase_2 ABC_tran NB-ARC NACHT AAA_14 AAA_29 ATP-synt_ab DAP3 Motif Other DBs NCBI-GeneID:  130545652 NCBI-ProteinID:  XP_057176265 LinkDB All DBs Position LG22:19376121..19378515 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSDIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLREEGTVSSGDSCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggttctcctgaaggtgattattcttggggattctggtgttgga aagacttcgctgatgaaccaatatgtcaataagaaattcagcaatcagtataaagccacg atcggtgctgactttcttaccaaggaggtgatggtggacgacaggctggtgacaatgcag atttgggacacagcaggacaggagcggtttcagtctttgggcgtggctttttatcgtgga gcggactgctgcgtgctggtgtacgatgtgactgcgccgaacaccttcaaaaccctggac agctggagggatgagttcctcattcaggccagcccacgcgacccagagaacttccctttt gtagtgcttggcaacaagatcgatttggagaacagacaggtgactacaaagcgagcacag gcgtggtgtcagagcaaaagtgacattccatactttgaaaccagtgcaaaagaggccatc aacgtggaccaggctttccaaaccatcgctcgtaatgcccttaaacaggagtctgaagtg gagacgtatgacttcccggaccagattaaactgcgagaggaaggaaccgtgtcctccggc gacagctgcagctgctga

DBGET integrated database retrieval system