Triplophysa rosa: 130548318 Help Entry 130548318         CDS       T09216                                  Name (RefSeq) C-C motif chemokine 13-like   KO K21095   C-C motif chemokine 22 Organism tros  Triplophysa rosa Pathway tros04060   Cytokine-cytokine receptor interaction tros04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130548318  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130548318  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tros04052]     130548318 Cytokines and neuropeptides [BR:tros04052]  Cytokines   Chemokines    130548318 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  130548318 NCBI-ProteinID:  XP_057181003 LinkDB All DBs Position LG2:35954497..35955253 Genome browser AA seq 102 aa AA seqDB search MRHLMMLLFLVIFCCLQLTTSAPVASDLAKSKCCSKFNNARIPLRRVKSYYWTSDNCPKR AIVFQTEKEICVDPETTWVSHHMAKVDNRTTTATPKTQTTTV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagacatctgatgatgctgctgtttctggtgatcttctgctgtctgcagctgactaca agtgctccagttgcctctgatttggcaaagtcaaagtgttgttccaagttcaataatgca cggattcctttgagacgtgtgaagtcgtactattggaccagcgataactgccccaaacgt gccattgtgtttcaaactgaaaaggagatctgtgtagacccagaaaccacctgggtgagc caccatatggctaaagtggacaacagaacaactacagctacaccaaagactcaaaccacc acagtctaa

DBGET integrated database retrieval system