Triplophysa rosa: 130549556 Help Entry 130549556         CDS       T09216                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04068   FoxO signaling pathway tros04081   Hormone signaling tros04114   Oocyte meiosis tros04140   Autophagy - animal tros04150   mTOR signaling pathway tros04810   Regulation of actin cytoskeleton tros04910   Insulin signaling pathway tros04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130549556 (ins)    04068 FoxO signaling pathway     130549556 (ins)    04150 mTOR signaling pathway     130549556 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     130549556 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130549556 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     130549556 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130549556 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     130549556 (ins)    04914 Progesterone-mediated oocyte maturation     130549556 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tros04052]     130549556 (ins) Cytokines and neuropeptides [BR:tros04052]  Neuropeptides   Unclassified    130549556 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Toxin_8 Motif Other DBs NCBI-GeneID:  130549556 NCBI-ProteinID:  XP_057182774 LinkDB All DBs Position LG2:complement(18863821..18866528) Genome browser AA seq 133 aa AA seqDB search MQIVPNHLTSLICYHLVISFKNRVIMALWLQAGALMLILAISGVNANAGAPQHLCGSHLV DALYLVCGPTGFFYNPKRDVNPLLGFLPPKSDQENDAADFAFKDHAELIRKRGIVEQCCH KPCSIFELQNYCN NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcagatcgtcccaaaccatctcacctctctcatctgttaccatctagtcatcagcttc aagaacagggtaataatggcattgtggctccaagctggtgctctcatgttgattttggcc atctctggtgtcaacgctaatgcaggggctccacagcacctgtgtggatctcacctagtc gacgctctttacctagtctgtggtccaaccggtttcttctataaccctaagagagatgtt aaccccctactgggtttccttcctcctaaatccgaccaggaaaatgatgcggctgacttt gcatttaaagatcatgctgagctgataagaaagagaggcatagtggagcagtgctgccac aaaccctgcagcatcttcgaactccagaattattgcaattaa

DBGET integrated database retrieval system