Triplophysa rosa: 130553578 Help Entry 130553578         CDS       T09216                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism tros  Triplophysa rosa Pathway tros03030   DNA replication tros03410   Base excision repair tros03420   Nucleotide excision repair tros03430   Mismatch repair tros03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tros00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     130553578 (pold4)    03410 Base excision repair     130553578 (pold4)    03420 Nucleotide excision repair     130553578 (pold4)    03430 Mismatch repair     130553578 (pold4)    03440 Homologous recombination     130553578 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tros03032]     130553578 (pold4)    03400 DNA repair and recombination proteins [BR:tros03400]     130553578 (pold4) DNA replication proteins [BR:tros03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     130553578 (pold4) DNA repair and recombination proteins [BR:tros03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       130553578 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      130553578 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  130553578 NCBI-ProteinID:  XP_057188611 LinkDB All DBs Position LG4:23906597..23912218 Genome browser AA seq 108 aa AA seqDB search MTQKRGLITDTYKIVKKTRRGGKRDKTPSPPKPEPEPPQLSEREKDLQELKKFDLDWTFG PCTGISRLQRWERAALHGLNPPQEIKEILLKENTDPEYTQSLWCDYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacacagaaacgtggactgatcactgacacctacaaaattgtgaagaagacaagaaga gggggaaagagagacaagacaccttcgcccccaaaaccagaacctgagcccccgcaactg agtgagcgagaaaaagatctacaagagctgaagaagtttgatctggactggacatttgga ccatgcactggcatcagtcgattgcaaagatgggagagggcagcactgcatgggcttaat cccccacaggagattaaagagattctgctgaaggagaatacagacccagagtacacacag agtctctggtgtgactatcccctctga

DBGET integrated database retrieval system