Triplophysa rosa: 130554426 Help Entry 130554426         CDS       T09216                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04012   ErbB signaling pathway tros04068   FoxO signaling pathway tros04137   Mitophagy - animal tros04140   Autophagy - animal tros04144   Endocytosis tros04150   mTOR signaling pathway tros04210   Apoptosis tros04218   Cellular senescence tros04370   VEGF signaling pathway tros04371   Apelin signaling pathway tros04510   Focal adhesion tros04540   Gap junction tros04625   C-type lectin receptor signaling pathway tros04810   Regulation of actin cytoskeleton tros04910   Insulin signaling pathway tros04912   GnRH signaling pathway tros04916   Melanogenesis tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130554426 (hrasb)    04012 ErbB signaling pathway     130554426 (hrasb)    04370 VEGF signaling pathway     130554426 (hrasb)    04371 Apelin signaling pathway     130554426 (hrasb)    04068 FoxO signaling pathway     130554426 (hrasb)    04150 mTOR signaling pathway     130554426 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130554426 (hrasb)    04140 Autophagy - animal     130554426 (hrasb)    04137 Mitophagy - animal     130554426 (hrasb)   09143 Cell growth and death    04210 Apoptosis     130554426 (hrasb)    04218 Cellular senescence     130554426 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130554426 (hrasb)    04540 Gap junction     130554426 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130554426 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130554426 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     130554426 (hrasb)    04912 GnRH signaling pathway     130554426 (hrasb)    04916 Melanogenesis     130554426 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130554426 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tros04131]     130554426 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tros04147]     130554426 (hrasb)    04031 GTP-binding proteins [BR:tros04031]     130554426 (hrasb) Membrane trafficking [BR:tros04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130554426 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     130554426 (hrasb) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    130554426 (hrasb)   Exosomal proteins of colorectal cancer cells    130554426 (hrasb) GTP-binding proteins [BR:tros04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130554426 (hrasb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  130554426 NCBI-ProteinID:  XP_057190044 LinkDB All DBs Position LG1:complement(28529995..28535148) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagttagtggtggtgggtgcaggtggtgtgggcaagagtgctttgacc atccaactcattcagaatcactttgttgatgaatacgacccaaccattgaggactcatac aggaagcaggtggtgattgatggagaaacgtgtcttttggatatcctggatactgcaggt caggaggagtacagtgcaatgagagaccaatacatgaggactggagagggttttctatgt gtctttgccatcaacaataccaagtctttcgaggacattcatcagtacagggaacagatt aagagggtgaaagactctgatgatgtgcctatggtgcttgtgggtaataaatgtgatcta ccagcccgcactgtggacacaagacaggcccatgaacttgcccgtagctatggtatacca tacattgaaacctcagcaaaaacaagacagggagtggaagatgctttttacacacttgtc cgtgaaattaggcaacacaagctgaggaaactgaaccctccagatgacaatggccaagac tgcatgaattgccgctgcgtggtgtcatga

DBGET integrated database retrieval system