Triplophysa rosa: 130558340 Help Entry 130558340         CDS       T09216                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04144   Endocytosis tros04370   VEGF signaling pathway tros04510   Focal adhesion tros04520   Adherens junction tros04530   Tight junction tros04810   Regulation of actin cytoskeleton tros04912   GnRH signaling pathway tros05100   Bacterial invasion of epithelial cells tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130558340 (cdc42l)    04370 VEGF signaling pathway     130558340 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130558340 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130558340 (cdc42l)    04520 Adherens junction     130558340 (cdc42l)    04530 Tight junction     130558340 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130558340 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     130558340 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130558340 (cdc42l)    05100 Bacterial invasion of epithelial cells     130558340 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tros04131]     130558340 (cdc42l)    03036 Chromosome and associated proteins [BR:tros03036]     130558340 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tros04147]     130558340 (cdc42l)    04031 GTP-binding proteins [BR:tros04031]     130558340 (cdc42l) Membrane trafficking [BR:tros04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130558340 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     130558340 (cdc42l)   Macropinocytosis    Ras GTPases     130558340 (cdc42l) Chromosome and associated proteins [BR:tros03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     130558340 (cdc42l) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of microglial cells    130558340 (cdc42l)   Exosomal proteins of breast milk    130558340 (cdc42l) GTP-binding proteins [BR:tros04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130558340 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  130558340 NCBI-ProteinID:  XP_057196696 LinkDB All DBs Position LG8:complement(23007577..23014613) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggtgatggagctgttggaaagacctgcctcctc atctcctacacgaccaacaaattcccatctgaatatgttcccacggtgtttgataactat gccgtaacagtgatgatcggaggagaaccatatacattggggctttttgacacagcaggt caggaagactacgacagacttcggcctctcagctatccgcagacagacgtcttcctggtt tgcttctctgtcgtttctccttcctcctttgagaacgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaagtcgacctgagg gacgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatatcgcccgaa agtggggagaagctggccagagacctcagagctgtgaaatatgtagagtgctccgccctc acgcagagaggtttgaagaatgtattcgacgaggcgatacttgccgcgcttgaacctccc gagacgaaaccgaagaaacgctgcatcctcttgtag

DBGET integrated database retrieval system