Triplophysa rosa: 130559638
Help
Entry
130559638 CDS
T09216
Name
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
tros
Triplophysa rosa
Pathway
tros00190
Oxidative phosphorylation
tros01100
Metabolic pathways
tros04148
Efferocytosis
tros04260
Cardiac muscle contraction
Module
tros_M00151
Cytochrome bc1 complex respiratory unit
tros_M00152
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:
tros00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
130559638
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
130559638
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
130559638
Enzymes [BR:
tros01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
130559638
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ubiq-Cytc-red_N
UCR_TM
Rieske
Motif
Other DBs
NCBI-GeneID:
130559638
NCBI-ProteinID:
XP_057198826
LinkDB
All DBs
Position
LG1:complement(26451375..26459033)
Genome browser
AA seq
273 aa
AA seq
DB search
MMSIAARSGTFSPYLQATNYAVAGPLKALIPGVVVKSDKMLMDVKKPFLCRESLGGQSAK
TGLSVSSSINARAGVRFAHTDIKIPDFSDYRRPEVLDPKKSSQDSGEARKTFSYLITGST
AVVGVYTAKTVVSQFVSSMSASADVLALSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTE
KEIAAEAGVDLSELRDPQHDKDRVLNPSWVIVIGVCTHLGCVPIANAGDYGGYYCPCHGS
HYDASGRIRKGPAPLNLEVPYYEFPDDDMVVVG
NT seq
822 nt
NT seq
+upstream
nt +downstream
nt
atgatgtctattgctgcccgttcggggacattttccccgtacctgcaagcaaccaactat
gctgttgcaggtccactaaaagctttaataccgggcgtagtcgtgaagagcgataaaatg
ttgatggatgtcaagaaaccgttcctctgccgagagtctttgggcggccagagcgctaag
accggcctctctgtgtcctccagcatcaacgctcgcgctggggtgcgttttgcccacaca
gacatcaagatccccgatttctctgactaccgccgacctgaagttttggacccaaagaag
tcatcgcaagacagtggtgaagcccgcaagaccttctcttatctgatcacaggttccaca
gctgtggttggagtctacacagctaagacagtggtctcgcagtttgtctcctccatgagc
gcctcagccgatgtgttggctctgtcgaagattgaaatcaagctatcagacatccccgag
ggtaagaatatgaccttcaaatggagagggaaacccctgtttgtccggcacaggacggaa
aaggagattgcagctgaggctggtgttgatctgtctgagcttcgggacccccagcatgac
aaagaccgcgttttgaacccatcctgggttattgtcatcggtgtgtgcacccacctggga
tgcgtgcccatcgctaatgctggtgactatggtggctattactgtccatgccacggctct
cattacgatgcatccggtcgcattagaaaaggccctgctccactcaacctggaggtcccc
tactacgagttcccagatgatgacatggtggttgttggataa
DBGET
integrated database retrieval system