KEGG   Triplophysa rosa: 130559659
Entry
130559659         CDS       T09216                                 
Symbol
slc30a6
Name
(RefSeq) zinc transporter 6
  KO
K14693  solute carrier family 30 (zinc transporter), member 6
Organism
tros  Triplophysa rosa
Brite
KEGG Orthology (KO) [BR:tros00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tros02000]
    130559659 (slc30a6)
Transporters [BR:tros02000]
 Solute carrier family (SLC)
  SLC30: Zinc efflux transporter
   130559659 (slc30a6)
SSDB
Motif
Pfam: Cation_efflux DUF2704
Other DBs
NCBI-GeneID: 130559659
NCBI-ProteinID: XP_057198843
LinkDB
Position
LG9:complement(1449030..1524745)
AA seq 543 aa
MALDGSSTSVIMAHNKAYQVHMCDYYSSTPDVVPSGVSERKISPSHTCDMMTLDVITIKD
SDAPVHRKKREVDTYVLGTIHPFRKTHRSILGKFFQEISLVASNRRSWRILLFGVLNLMC
TACLLMWCSSTNSMALTAYTYLTIFDLFSLLTCFLSFWVSMKKPSQVYTFGFERFEVLAV
FASTVLVQLGALFILKESVERFVEQPEVHTGRLLVGTFVALFFNLLTLLSVKNKPFVFVS
EAASTSWLQEHVADLSRSVCGLIPALSSFLLPRMNPFVLINLAGAGALGITYMLIEINNY
NAMDTATAIAIALMTFGTMYPMSVYSGKVLLQTTPSHVIGQLDKLLREVSTLDGVLEVRN
EHFWTIGFGSLAGSVHVRIRRDADEQMVLAHVTNRLNAQVSVLTVQIFKDDWSRPSLTGG
VLPTGSLSLSEYVTSAAFPPAVTKQLEECDPVTSTPAKPSSPPPEFSFNTPGKHIQPVVF
PMAQQHRPYSSGVLKQGLGQAGGAAAMRLGFGVPSDQGYRTVNTVPHRYTSNLSPSQTDQ
QRP
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggcgctggacggctcgtccacgtctgtgataatggctcacaataaggcataccaggtt
cacatgtgtgattattacagcagtacacccgatgtagtgccctcaggagtcagcgagagg
aagatctctccctcacacacgtgcgatatgatgacgctggatgtcatcaccattaaagac
tcggatgctccagtccacaggaagaaacgtgaagttgacacttatgtgctgggcacgata
catccattccggaaaactcacaggtccatcctggggaagtttttccaagagattagcttg
gttgcctctaacagacggtcgtggaggattcttctctttggtgtcttgaatctgatgtgt
acggcctgtctgctgatgtggtgcagttctaccaacagtatggctttaactgcatatacg
tacctcactatcttcgatctcttcagtcttctcacatgttttctgagtttctgggtgagc
atgaagaagcccagtcaggtctacacttttgggttcgagcggttcgaggtgttggcggtg
ttcgcctccactgtgttggttcagctgggtgctctcttcatcctgaaggagagtgtcgag
cggtttgtggagcagccagaggttcacaccggtcgtctgttggtgggaacatttgtggct
ctgttctttaatctgttgactctactgtcagtgaagaacaaacccttcgtctttgtgtct
gaagcggcgagcaccagctggcttcaggaacatgtggccgatctgagtcgaagtgtgtgt
ggactcatcccggcgctcagcagttttctgttacccagaatgaatcccttcgtgctgata
aacctcgccggcgccggcgctctcggcatcacgtacatgcttattgaaatcaataattat
aatgcgatggacacggccactgccatcgccatcgccctcatgaccttcggcaccatgtat
cccatgagcgtgtacagcgggaaagttctgcttcagaccaccccctctcatgtgattggt
cagcttgataaactgctccgagaggtctctacgctggatggagttcttgaagtcagaaat
gaacatttctggaccattggctttggctctttggccggctcggtccacgtgcgcatccgc
agggacgctgatgagcagatggttctggctcacgtcaccaaccgcttgaacgcacaggtg
tccgtgcttacagttcagatcttcaaagacgactggagccgtccctcgctgacggggggc
gttctcccgaccggctcgctcagtctctccgagtacgtcacttctgctgcctttcctccc
gccgtgaccaaacaactggaggagtgtgacccggtcacgtctacacccgcgaagcccagc
agcccaccgcccgagttctccttcaacactccgggaaagcacatccagccggtggtgttt
ccgatggcccagcagcacaggccgtactcttccggtgtgctgaagcaaggtttgggtcag
gccggcggtgccgctgccatgaggctgggctttggcgtgccgtccgatcagggttacagg
actgtgaacacagtcccacacagatacacaagcaatctgtctccatcacaaacagatcaa
cagagaccgtga

DBGET integrated database retrieval system