Triplophysa rosa: 130560101 Help Entry 130560101         CDS       T09216                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism tros  Triplophysa rosa Pathway tros04060   Cytokine-cytokine receptor interaction tros04218   Cellular senescence tros04620   Toll-like receptor signaling pathway tros04621   NOD-like receptor signaling pathway tros04622   RIG-I-like receptor signaling pathway tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130560101 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     130560101 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130560101 (cxcl19)    04621 NOD-like receptor signaling pathway     130560101 (cxcl19)    04622 RIG-I-like receptor signaling pathway     130560101 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130560101 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tros04052]     130560101 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:tros00536]     130560101 (cxcl19) Cytokines and neuropeptides [BR:tros04052]  Cytokines   Chemokines    130560101 (cxcl19) Glycosaminoglycan binding proteins [BR:tros00536]  Heparan sulfate / Heparin   Chemokines    130560101 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  130560101 NCBI-ProteinID:  XP_057199579 LinkDB All DBs Position LG1:4865471..4866572 Genome browser AA seq 102 aa AA seqDB search MKFFLMLMLIGASILFSKAMQPFGPGYNSHCMCVKLESRVIPPDNLQSVEILPRGHHCKT TEVIAGLSSGEKICLNPRTPWVKKLINFIEKKNEATRKNKIH NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaagttcttcctgatgttaatgttgattggagccagcatccttttctccaaagctatg cagcctttcggcccaggttacaacagccactgcatgtgtgtaaaactggagtcgagggta atcccaccagataacttgcaaagtgtggagatcttgccaagaggtcatcactgtaagact acagaggtcattgccggtttatcaagtggagagaagatctgccttaaccccaggacacca tgggttaaaaaactcattaactttattgagaaaaagaacgaagcaacaagaaagaataaa atacactaa

DBGET integrated database retrieval system