Triplophysa rosa: 130561042 Help Entry 130561042         CDS       T09216                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04137   Mitophagy - animal tros04140   Autophagy - animal tros04218   Cellular senescence tros04371   Apelin signaling pathway tros04625   C-type lectin receptor signaling pathway tros04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130561042 (rras)    04371 Apelin signaling pathway     130561042 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130561042 (rras)    04137 Mitophagy - animal     130561042 (rras)   09143 Cell growth and death    04218 Cellular senescence     130561042 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130561042 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130561042 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tros04147]     130561042 (rras)    04031 GTP-binding proteins [BR:tros04031]     130561042 (rras) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130561042 (rras)   Exosomal proteins of bladder cancer cells    130561042 (rras) GTP-binding proteins [BR:tros04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130561042 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  130561042 NCBI-ProteinID:  XP_057201113 LinkDB All DBs Position LG11:12557524..12561285 Genome browser AA seq 138 aa AA seqDB search MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILD TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYNEIQKFHTQILRVKDRDDFPMVLVANK SDLEQQRAVSKEDAIAFA NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgtcaacggaagaaagatataagttagtggtcgtgggcggtggaggtgttgggaaaagc gcactcactattcagttcattcagtcatactttgtgtctgactatgacccaaccattgaa gactcgtacactaaaatctgcacagtggatggaaaggagacacgattagacatactcgac acagcaggacaagaagagtttggcgcaatgagagagcaatacatgcgctctggagagggt ttcttactggtgttcgctttaaatgacagtggcagttataatgaaattcagaaatttcac actcagattttgcgggtaaaggatcgagatgactttcccatggttcttgttgccaacaaa tccgatcttgagcagcagagagcggtctcaaaggaggacgccattgcatttgcctga

DBGET integrated database retrieval system