Triplophysa rosa: 130564545 Help Entry 130564545         CDS       T09216                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism tros  Triplophysa rosa Pathway tros04517   IgSF CAM signaling tros04814   Motor proteins tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130564545 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     130564545 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130564545 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tros03037]     130564545 (dynll2a)    04812 Cytoskeleton proteins [BR:tros04812]     130564545 (dynll2a) Cilium and associated proteins [BR:tros03037]  Motile cilia and associated proteins   Dynein arm    130564545 (dynll2a) Cytoskeleton proteins [BR:tros04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      130564545 (dynll2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  130564545 NCBI-ProteinID:  XP_057206654 LinkDB All DBs Position LG14:complement(10392592..10395148) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggctgtgatcaagaacgctgacatgtctgaagatatgcagcaggat gctgtcgattgtgccacacaggcaatggagaaatacaacatcgagaaggacattgctgca tacatcaaaaaggagttcgataagaaatacaatccgacgtggcattgcattgtgggaagg aacttcggcagctatgtgacccacgagacgaaacacttcatctacttctacttggggcag gtggccattctcctgttcaagtctggctga

DBGET integrated database retrieval system