Triplophysa rosa: 130564545 Help Entry 130564545         CDS       T09216                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism tros  Triplophysa rosa Pathway tros04814   Motor proteins tros05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tros00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     130564545 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130564545 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tros03037]     130564545 (dynll2a)    04812 Cytoskeleton proteins [BR:tros04812]     130564545 (dynll2a) Cilium and associated proteins [BR:tros03037]  Motile cilia and associated proteins   Dynein arm    130564545 (dynll2a) Cytoskeleton proteins [BR:tros04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      130564545 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  130564545 NCBI-ProteinID:  XP_057206654 LinkDB All DBs Position LG14:complement(10392592..10395148) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggctgtgatcaagaacgctgacatgtctgaagatatgcagcaggat gctgtcgattgtgccacacaggcaatggagaaatacaacatcgagaaggacattgctgca tacatcaaaaaggagttcgataagaaatacaatccgacgtggcattgcattgtgggaagg aacttcggcagctatgtgacccacgagacgaaacacttcatctacttctacttggggcag gtggccattctcctgttcaagtctggctga

DBGET integrated database retrieval system