Triplophysa rosa: 130567677 Help Entry 130567677         CDS       T09216                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04012   ErbB signaling pathway tros04068   FoxO signaling pathway tros04137   Mitophagy - animal tros04140   Autophagy - animal tros04150   mTOR signaling pathway tros04210   Apoptosis tros04218   Cellular senescence tros04370   VEGF signaling pathway tros04371   Apelin signaling pathway tros04540   Gap junction tros04625   C-type lectin receptor signaling pathway tros04810   Regulation of actin cytoskeleton tros04910   Insulin signaling pathway tros04912   GnRH signaling pathway tros04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130567677 (nras)    04012 ErbB signaling pathway     130567677 (nras)    04370 VEGF signaling pathway     130567677 (nras)    04371 Apelin signaling pathway     130567677 (nras)    04068 FoxO signaling pathway     130567677 (nras)    04150 mTOR signaling pathway     130567677 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130567677 (nras)    04137 Mitophagy - animal     130567677 (nras)   09143 Cell growth and death    04210 Apoptosis     130567677 (nras)    04218 Cellular senescence     130567677 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     130567677 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130567677 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130567677 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     130567677 (nras)    04912 GnRH signaling pathway     130567677 (nras)    04916 Melanogenesis     130567677 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tros04131]     130567677 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tros04147]     130567677 (nras)    04031 GTP-binding proteins [BR:tros04031]     130567677 (nras) Membrane trafficking [BR:tros04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130567677 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     130567677 (nras) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130567677 (nras)   Exosomal proteins of other body fluids (saliva and urine)    130567677 (nras)   Exosomal proteins of breast cancer cells    130567677 (nras)   Exosomal proteins of colorectal cancer cells    130567677 (nras) GTP-binding proteins [BR:tros04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130567677 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  130567677 NCBI-ProteinID:  XP_057211931 LinkDB All DBs Position LG17:19702801..19709272 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGVEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSSEDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggttgttgtgggagcaggtggtgtcgggaaaagcgctttaacc atccagctcattcagaatcactttgtggatgaatatgaccccactattgaggactcttac aggaagcaggtggtgattgatggcgagacgtgtctgctggacatcctggacactgccggt caggaggagtacagcgctatgagagaccagtacatgaggacgggagagggcttcctatgc gtctttgctataaacaacagcaaatccttcgctgatgtgcacttgtacagagagcagatc aagcgagttaaagactctgatgacgttccgatggttctagtggggaacaagtgtgatctg gctagaacggtggacaccaaacaggctcaggaacttgccagaagttacggcgtagagttt gtggaaacttcagccaagactagacagggagtcgaagacgctttttacaccctcgttcgt gagatccggcattatcgcatgaaaaagctcaacagcagcgaggacagaaagcagggctgc ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system