Triplophysa rosa: 130570766 Help Entry 130570766         CDS       T09216                                  Symbol cldn28 Name (RefSeq) claudin-4   KO K06087   claudin Organism tros  Triplophysa rosa Pathway tros03272   Virion - Hepatitis viruses tros04382   Cornified envelope formation tros04514   Cell adhesion molecules tros04530   Tight junction Brite KEGG Orthology (KO) [BR:tros00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     130570766 (cldn28)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     130570766 (cldn28)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     130570766 (cldn28)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     130570766 (cldn28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tros03037]     130570766 (cldn28)    04147 Exosome [BR:tros04147]     130570766 (cldn28)    04515 Cell adhesion molecules [BR:tros04515]     130570766 (cldn28) Cilium and associated proteins [BR:tros03037]  Other cilia and associated proteins   Stereociliary proteins    130570766 (cldn28) Exosome [BR:tros04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    130570766 (cldn28)   Exosomal proteins of colorectal cancer cells    130570766 (cldn28) Cell adhesion molecules [BR:tros04515]  Immunoglobulin superfamily   L1 family    130570766 (cldn28) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Clc-like Motif Other DBs NCBI-GeneID:  130570766 NCBI-ProteinID:  XP_057217196 LinkDB All DBs Position LG19:complement(11339261..11340230) Genome browser AA seq 162 aa AA seqDB search MKRRQLLAVFLAVVGMCGTILVCALPMWKVTAFVGANIVTAQVFWEGLWMNCVLQSTGHM QCKAYDSILALTQDLQAARALICASIGVSVVAIGLTVVGAECTNFYREERFTKNKFGITA GAVFIVAERRGELGASIYVGWVAGVLLIVGGGLLTSTYSNRC NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgaagagaagacagctcttggctgtatttctggctgtcgtgggtatgtgtggaactatt ctggtctgtgctctgcctatgtggaaagtgactgcgttcgtgggagccaatattgtgacg gcacaggttttctgggagggtttgtggatgaactgtgttctgcagagcaccggtcacatg caatgcaaagcgtatgactccatcctggctctgacgcaagatctccaagcagctcgagct ttaatctgtgcctctatcggtgtaagcgtggttgccattggattgacagttgttggggct gagtgcactaacttctacagagaggagcggtttaccaaaaacaaatttggaataacagct ggagcggtctttatagtcgcagagagaagaggagaactgggagcttcgatctatgtagga tgggtggccggtgttctcctaatcgtaggtggtggattactcaccagcacatactccaac cgatgctga

DBGET integrated database retrieval system