Treponema sp. OMZ 803: ABH09_03390 Help Entry ABH09_03390       CDS       T09263                                  Symbol dut Name (GenBank) dUTP diphosphatase   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism trp  Treponema sp. OMZ 803 Pathway trp00240   Pyrimidine metabolism trp01100   Metabolic pathways trp01232   Nucleotide metabolism Module trp_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:trp00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     ABH09_03390 (dut)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:trp03400]     ABH09_03390 (dut) Enzymes [BR:trp01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      ABH09_03390 (dut) DNA repair and recombination proteins [BR:trp03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     ABH09_03390 (dut)  Prokaryotic type     ABH09_03390 (dut) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dUTPase DCD Motif Other DBs NCBI-ProteinID:  UTC53716 LinkDB All DBs Position 725403..725858 Genome browser AA seq 151 aa AA seqDB search MSIADGAVRVFSVLKEGALLPEYQTSGSAGADLHAYLAEPVTLKPMERRLIPTGLFVELP AGYELQVRPRSGLALKHGVTVLNTPGTVDSDYRGELCVLLINFGSEPFTVQNGDRIAQAV VAQAVQVSFVQTDALSETGRGVNGYGSTGIA NT seq 456 nt NT seq  +upstreamnt  +downstreamnt gtgagtatcgctgacggggcagtaagagttttttccgtactcaaggaaggagccttactg cctgaatatcaaacatccggttccgccggcgcagatttacatgcgtatttggctgaaccg gtaacgctgaagccgatggagcgtaggcttatcccgacggggttatttgttgaattgcct gcaggctatgaattgcaggtacgtccgcgttcgggacttgcgttaaagcatggcgtcacg gtactcaatactcccggcacggtggattccgactaccgtggagaactgtgtgtgctgttg ataaattttggcagcgaaccctttaccgtacaaaacggcgatagaattgcgcaggcagtc gtggctcaggcggtacaggtgagctttgtgcaaactgatgcactttcagaaaccggacgg ggtgtcaatggatacggttcaaccggcatcgcataa

DBGET integrated database retrieval system