Terriglobus roseus: Terro_0562 Help Entry Terro_0562        CDS       T02140                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism trs  Terriglobus roseus Pathway trs01100   Metabolic pathways trs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:trs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Terro_0562    00074 Mycolic acid biosynthesis     Terro_0562   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Terro_0562 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFL86902 UniProt:  I3ZCD4 LinkDB All DBs Position complement(625880..626122) Genome browser AA seq 80 aa AA seqDB search MASVDEKVKGIIVEQLQVDEAEVTPGASFQEDLGADSLDVVELVMQFEEAFDIQIPDEDA EKIKTVKDATDYIEAHAKAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcatcggttgacgagaaggttaaaggcatcatcgtagagcagcttcaggtggatgag gctgaggtaaccccgggcgcgtccttccaggaagatctgggagctgattcgctcgacgtg gtcgaactggtgatgcagtttgaagaggccttcgatatccagatcccggatgaagacgcc gagaagatcaagactgtaaaggacgcaacggactacatcgaagcgcacgcaaaggctaag taa

DBGET integrated database retrieval system