Terriglobus roseus: Terro_1833 Help Entry Terro_1833        CDS       T02140                                  Name (GenBank) flagellar hook capping protein   KO K02389   flagellar basal-body rod modification protein FlgD Organism trs  Terriglobus roseus Pathway trs02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:trs00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Terro_1833  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:trs02035]     Terro_1833 Bacterial motility proteins [BR:trs02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Terro_1833 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgD Motif Other DBs NCBI-ProteinID:  AFL88125 UniProt:  I3ZFV7 LinkDB All DBs Position 2173078..2173380 Genome browser AA seq 100 aa AA seqDB search MNSLTTTNFMTQQTARVSAYASSASSNSSADDATTITSSDFLTLLVTQMKNQDPTEPTDP SQYLQQLVGVNSLEQLIDVNKQLTSLGGSTATSTTSAAGV NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaactccttgacgacaacgaatttcatgacacagcagacggcacgtgtctcggcctat gcgtcttccgcatccagtaacagtagtgccgacgatgcaacgacgatcacctccagcgac tttctgacgttgctggttactcagatgaagaaccaggatccaactgagcccaccgatccg agccagtatctccagcagcttgttggcgtgaacagcctggaacaactgatcgacgtgaac aagcagttgacgtctctcggcggttcaaccgccacttccaccacttcagccgcaggcgtt taa

DBGET integrated database retrieval system