Terriglobus roseus: Terro_3793
Help
Entry
Terro_3793 CDS
T02140
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
trs
Terriglobus roseus
Pathway
trs00770
Pantothenate and CoA biosynthesis
trs01100
Metabolic pathways
trs01240
Biosynthesis of cofactors
Module
trs_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
trs00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
Terro_3793
Enzymes [BR:
trs01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
Terro_3793
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Birna_VP2
Motif
Other DBs
NCBI-ProteinID:
AFL90002
UniProt:
I3ZL84
LinkDB
All DBs
Position
complement(4507382..4507909)
Genome browser
AA seq
175 aa
AA seq
DB search
MQTVRAIYPGTFDPPTNGHLDLVSRGSTIFDHLVVAVLRNSSKGAPLFTTSERVDMLREA
THSFGNVSVETFDGLLVDFARKQGAKAVLRGIRAISDYEYEFQMAMMNRKLDKTLETVFM
MPAEKYTYVSSRLIKGVYQLNGDISELVPPLVLERLQQKRAAHVAPLGGEVPGEV
NT seq
528 nt
NT seq
+upstream
nt +downstream
nt
atgcagaccgtccgcgcgatttatcccggaactttcgatccgcccacgaatgggcacctt
gacctggtgagccgcgggtctacgatcttcgatcacctggtggttgccgtgctgcggaac
tccagcaagggcgcaccgctgttcacgacgtctgagcgtgtggacatgttgcgggaggcg
acgcattcctttggaaatgtgtcggtggagacctttgacggtctgctggtggattttgcc
cgtaagcagggggcgaaggcggttttgagaggtattcgcgcgatttcggactatgagtac
gagttccagatggcaatgatgaaccgcaagctggacaagacgctggagaccgtcttcatg
atgcctgcggaaaagtacacgtatgtctcctcgcgactgatcaagggcgtctaccagttg
aatggcgatatcagcgagctggtgcccccgctggtgctggagcggctgcagcaaaagcgc
gcggcgcatgtcgctccgctgggcggagaggttccgggcgaagtttag
DBGET
integrated database retrieval system