Takifugu rubripes (torafugu): 101063792 Help Entry 101063792         CDS       T02386                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism tru  Takifugu rubripes (torafugu) Pathway tru04115   p53 signaling pathway tru04137   Mitophagy - animal tru04140   Autophagy - animal tru04210   Apoptosis tru04621   NOD-like receptor signaling pathway tru05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tru00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101063792    04137 Mitophagy - animal     101063792   09143 Cell growth and death    04210 Apoptosis     101063792    04115 p53 signaling pathway     101063792  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101063792  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     101063792  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tru01009]     101063792   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tru03036]     101063792   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tru02000]     101063792 Protein phosphatases and associated proteins [BR:tru01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101063792 Chromosome and associated proteins [BR:tru03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101063792 Transporters [BR:tru02000]  Other transporters   Pores ion channels [TC:1]    101063792 SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 TraD Myosin_TH1 Motif Other DBs NCBI-GeneID:  101063792 NCBI-ProteinID:  XP_003964431 LinkDB All DBs Position 5:1217293..1218950 Genome browser AA seq 188 aa AA seqDB search MSNRELVENYLIYKLSQKNYPGTLLRPKDALSGLLVDRESSGTSPSTGTGREDVNAALWS MANKFEQDFIQLAGDLSSYGAMTRNQASFNKVMDNMFSDEINWGTVVGLFVVGGAICGQS VEGDASEPVCHIADWMAAYLDKRINPWIESQGGWDCFAAIYGEEACTNRAQEERRKWILG GLVVLAGV NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgtctaatagagagctggtagagaactatttaatctacaaactctctcagaagaactac ccaggcactctgctcagaccaaaggatgccttaagcggtttgctggttgatagagagagc agtggaacgtctccatccacaggtactggcagagaggatgtgaacgcagctctttggagc atggcaaataagttcgagcaggactttattcagctagcaggtgacctctcctcatacggc gccatgactcgtaaccaggcaagctttaacaaggtgatggacaacatgttcagtgatgaa atcaactggggaacagttgtgggtctttttgtcgtgggcggcgccatttgtgggcaatct gtcgagggtgacgcaagtgaaccggtttgccacattgcagactggatggcggcttacttg gacaaacggattaacccatggattgagagtcaaggaggatgggattgctttgctgccatt tatggggaagaagcctgcacaaacagagctcaggaagaaaggcgtaaatggatactgggc ggactggtggtgctggctggtgtttag

DBGET integrated database retrieval system