Takifugu rubripes (torafugu): 101065219 Help Entry 101065219         CDS       T02386                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism tru  Takifugu rubripes (torafugu) Pathway tru04382   Cornified envelope formation tru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tru00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101065219  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101065219  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tru04147]     101065219 Exosome [BR:tru04147]  Exosomal proteins   Exosomal proteins of microglial cells    101065219 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH Astro_p19 NNH2 Motif Other DBs NCBI-GeneID:  101065219 NCBI-ProteinID:  XP_003969338 Ensembl:  ENSTRUG00000011111 LinkDB All DBs Position 12:complement(12184403..12185918) Genome browser AA seq 100 aa AA seqDB search MPSELEIAMESLIKVFHRYASKEGRSGTLSRRELRELMENELTNFLRSQKDPAAVDKIMR DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQTHMRKSGRM NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcggaactggagatagcaatggagtcactcatcaaagtgttccaccgttacgcc tccaaggagggtcggagcggcaccctcagccggcgggagctccgggagctgatggagaac gagctgaccaacttcctgcggtctcagaaggaccccgctgcggtcgataaaatcatgagg gacctggacaccaacggcgacggccaggtggattttgaagagttcgtgtctctggttgtc ggactgtccatcgcttgtgagcagtgctatcagacgcacatgaggaagagcgggaggatg taa

DBGET integrated database retrieval system