Takifugu rubripes (torafugu): 101066885 Help Entry 101066885         CDS       T02386                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism tru  Takifugu rubripes (torafugu) Pathway tru03030   DNA replication tru03082   ATP-dependent chromatin remodeling tru03410   Base excision repair tru03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101066885 (pole3)    03410 Base excision repair     101066885 (pole3)    03420 Nucleotide excision repair     101066885 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101066885 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tru03032]     101066885 (pole3)    03036 Chromosome and associated proteins [BR:tru03036]     101066885 (pole3)    03400 DNA repair and recombination proteins [BR:tru03400]     101066885 (pole3) Enzymes [BR:tru01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101066885 (pole3) DNA replication proteins [BR:tru03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101066885 (pole3) Chromosome and associated proteins [BR:tru03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     101066885 (pole3) DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101066885 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase DUF3276 Afi1 AAA_11 DMP19 Motif Other DBs NCBI-GeneID:  101066885 NCBI-ProteinID:  XP_003969653 Ensembl:  ENSTRUG00000024772 UniProt:  A0A674P5E8 LinkDB All DBs Position 13:11546658..11548500 Genome browser AA seq 144 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLKEALEVYKKGQKGKKEVSEQKRKDKEKKNSEIDKS REEEEEEEEERMLEEPEVEEDVES NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaagacctgaatcttcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggagtgaatgtgtcaaaagaggccagaagagccatatctcaagct gccagtgtcttcgtgctgtatgcaacatcctgtgcaaacaactttgcaatgaaggccaaa cggaaaactctgaatgcaggagatgttttagctgccatggaagagatggaatttgaacga ttcctggagcctcttaaagaagctttggaggtgtacaagaagggccagaaaggaaaaaag gaagtgtccgagcagaagcgcaaagacaaagagaagaaaaacagtgagattgataagagc agagaagaggaggaggaagaagaggaagagcgcatgttagaggagcctgaggtagaggag gatgtggaaagctga

DBGET integrated database retrieval system