Takifugu rubripes (torafugu): 101068670 Help Entry 101068670         CDS       T02386                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism tru  Takifugu rubripes (torafugu) Pathway tru04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101068670  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tru04121]     101068670    03400 DNA repair and recombination proteins [BR:tru03400]     101068670 Ubiquitin system [BR:tru04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101068670    Cul5 complex      101068670 DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101068670 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101068670 NCBI-ProteinID:  XP_003961318 UniProt:  A0A3B5K074 LinkDB All DBs Position 1:complement(12741862..12744092) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQILEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttttaatgatccggcgtcacaagaccacaatctttacagatgccaaggaa tccacaactgtttatgaacttaagcgcattgtagaaggaattcttaagagaacacctgaa gaccagaggctgtataaggatgaccagatactagaggacagcaaaactcttggtgattgt ggattcactaatcagactgccagaccacaggctccagctacagtgggtctggcttttcgc ataaatgatgagatgttcgaacagctgcatattgaagccttttccagcccccccgaacta ccagatgtgatgaagcctcaggactctggcagcacggccaacgagcaggctgtgcagtga

DBGET integrated database retrieval system