Takifugu rubripes (torafugu): 101070508 Help Entry 101070508         CDS       T02386                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism tru  Takifugu rubripes (torafugu) Pathway tru04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101070508  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tru04121]     101070508    03400 DNA repair and recombination proteins [BR:tru03400]     101070508 Ubiquitin system [BR:tru04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      101070508    Cul5 complex      101070508 DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101070508 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101070508 NCBI-ProteinID:  XP_011602567 LinkDB All DBs Position 5:12739050..12741671 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDLLLSDGQTLGNC GFTNQTARPQGPATVGLAFRLGDDTFEQLRVEPFSTPPELPDVMKPQDSGSTANEQVVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttcttatgattcgacgtcataagacgacgatcttcaccgatgccaaagag tccaccaccgtttacgagctgaagcgcatcgtggaagggatcctgaagaggccgcctgag gaccagaggctttacaaggacgacttgttgctgagcgacggacagacgttaggaaactgc ggcttcaccaaccagacggcgcggcctcagggcccggccacggtgggcttggccttccgc ctgggggatgacacgttcgagcagctgagggtggagcctttctccaccccccctgagctc cccgacgtcatgaagccgcaggactctggcagcacagccaacgagcaggtcgtccagtga

DBGET integrated database retrieval system