Takifugu rubripes (torafugu): 101075521 Help Entry 101075521         CDS       T02386                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism tru  Takifugu rubripes (torafugu) Pathway tru04068   FoxO signaling pathway tru04136   Autophagy - other tru04140   Autophagy - animal tru04621   NOD-like receptor signaling pathway tru04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101075521 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101075521 (atg12)    04136 Autophagy - other     101075521 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101075521 (atg12)    04622 RIG-I-like receptor signaling pathway     101075521 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tru04131]     101075521 (atg12)    04121 Ubiquitin system [BR:tru04121]     101075521 (atg12)    03029 Mitochondrial biogenesis [BR:tru03029]     101075521 (atg12) Membrane trafficking [BR:tru04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101075521 (atg12) Ubiquitin system [BR:tru04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101075521 (atg12) Mitochondrial biogenesis [BR:tru03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101075521 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 ARTD15_N XendoU Motif Other DBs NCBI-GeneID:  101075521 NCBI-ProteinID:  XP_003966293 Ensembl:  ENSTRUG00000025328 UniProt:  A0A674P1N5 LinkDB All DBs Position 7:14888644..14890529 Genome browser AA seq 117 aa AA seqDB search MSDNAESPAELQKEEPQPAPEDSTTNDQKKKIDLLLKAVGDTPIMKQKKWAVERGRTVQS LSQFISRFLKLDAGEQLFIYVNQSFAPSPDQDVGVLFDCFGSDGKLVLHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtcagacaatgcagaatcccccgcagaattgcaaaaagaggagcctcaaccagcgcca gaggactcgacgacaaatgaccagaagaaaaaaatcgatttgctgctgaaggctgtgggc gataccccgatcatgaagcagaagaagtgggctgtggagcgggggcggacggtgcagtcc ctgtctcagttcatctctcgcttcctcaaactggatgccggtgaacaactgttcatttat gttaaccagtcattcgccccttcaccagaccaggacgttggagtcctttttgattgtttt ggcagtgatggcaagttggtcctacattactgtaaatctcaagcctggggttaa

DBGET integrated database retrieval system