Takifugu rubripes (torafugu): 101075993 Help Entry 101075993         CDS       T02386                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism tru  Takifugu rubripes (torafugu) Pathway tru04140   Autophagy - animal tru04150   mTOR signaling pathway tru04218   Cellular senescence tru04910   Insulin signaling pathway tru05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     101075993 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101075993 (rheb)   09143 Cell growth and death    04218 Cellular senescence     101075993 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     101075993 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     101075993 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tru04031]     101075993 (rheb) GTP-binding proteins [BR:tru04031]  Small (monomeric) G-proteins   Ras Family    Rheb     101075993 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase AAA_14 RhoGAP_pG1_pG2 Reovirus_M2 STIV_penton_2nd ParE_toxin YebF Motif Other DBs NCBI-GeneID:  101075993 NCBI-ProteinID:  XP_003975356 Ensembl:  ENSTRUG00000004902 UniProt:  A0A3B5KK68 LinkDB All DBs Position 22:3545068..3550098 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFRRMILEAEKMDGGVQPGKTS CSMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcacgaaaaatcgccatcctcgggtacagatccgtaggaaagtca tccctgacgattcagttcgtggaaggccagtttgttgactcctatgacccaacaatagaa aacacatttacaaagatgatcacaataaacggacaggagtaccatcttcagctggtagac acagctggacaggacgagtactccatcttccctcagacatactccatagatatcaacggt tacatcctggtctattcagtcacatctaataaaagctttgaagttgtacaagttatccac gaaaagctgttggacatggtgggaaaagttcaggttccaattatgctagtcggaaataag aacgacctacatatggagcgggtaatcagttgcgaagaaggaaaagcattagctgaatcc tggaatgctgctttcatggaatcctcagctaaggagaaccagacggctgtggaggttttc cgaaggatgatcctggaggcagagaagatggacggcggcgtgcaaccgggaaaaacatcc tgctccatgatgtag

DBGET integrated database retrieval system