Takifugu rubripes (torafugu): 101076529 Help Entry 101076529         CDS       T02386                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism tru  Takifugu rubripes (torafugu) Pathway tru04137   Mitophagy - animal tru04140   Autophagy - animal tru04144   Endocytosis tru04145   Phagosome tru04148   Efferocytosis tru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tru00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101076529    04145 Phagosome     101076529    04140 Autophagy - animal     101076529    04137 Mitophagy - animal     101076529    04148 Efferocytosis     101076529  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101076529  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tru04131]     101076529   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tru04147]     101076529    04031 GTP-binding proteins [BR:tru04031]     101076529 Membrane trafficking [BR:tru04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101076529 Exosome [BR:tru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101076529   Exosomal proteins of other body fluids (saliva and urine)    101076529   Exosomal proteins of colorectal cancer cells    101076529   Exosomal proteins of bladder cancer cells    101076529 GTP-binding proteins [BR:tru04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101076529 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  101076529 NCBI-ProteinID:  XP_003973592 Ensembl:  ENSTRUG00000020093 UniProt:  H2TL08 LinkDB All DBs Position 19:14283752..14287897 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtgctactcaaagtcatcatccttggagactcaggagttggc aagacctcactgatgaatcagtatgtgaataagaagttcagcaaccagtataaagctaca ataggtgctgatttcctgacaaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggatacggcaggccaggagcggttccagtccttaggtgtggctttctaccgtgga gctgactgctgcgtcctggtgtttgatgtcacggcgccaaacaccttcaagactttggac agctggcgggatgagttcttgatccaggccagccctcgagatccagagaacttccccttt gtggttttgggtaataagattgacttggagaacagacaggtaacaaccaagcgggcacag gcctggtgtcagagcaagaacaacatcccgtattttgaaaccagcgccaaggaggcgatc aacgtggagcaggccttccagaccattgcacgcaacgcccttaaacaggagaccgaagtg gagttgtacaacgagttccctgagccgataaaactggaccggaacgaaagagccaagccg tcagcagagacctgcagctgctga

DBGET integrated database retrieval system