Takifugu rubripes (torafugu): 101078211 Help Entry 101078211         CDS       T02386                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism tru  Takifugu rubripes (torafugu) Pathway tru03082   ATP-dependent chromatin remodeling tru04217   Necroptosis Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101078211  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101078211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tru03036]     101078211   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tru04147]     101078211 Chromosome and associated proteins [BR:tru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101078211 Exosome [BR:tru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101078211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101078211 NCBI-ProteinID:  XP_003979102 Ensembl:  ENSTRUG00000022299 UniProt:  A0A3B5KRU7 LinkDB All DBs Position 10:1820242..1820993 Genome browser AA seq 125 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgagtggtcgaggaaaaaccggcggcaaagcccgcgctaaggccaagactcgctcttct cgggctgggctccagttcccagtgggccgtgttcacaggctgctccgcaagggcaactat gctgagcgcgttggcgccggcgctcctgtgtacctggccgctgtgctggagtatctgacg gctgagatcctggagttggctggaaacgctgcccgcgacaacaagaagactcgtatcatc ccccgccacctgcagctggctgtgcgcaacgacgaggagctgaacaagctgctgggagga gtgacgatcgctcagggcggcgtgttgcccaacatccaggctgtcctgctgcccaagaag accgagaaggccaaataa

DBGET integrated database retrieval system