Takifugu rubripes (torafugu): 101079899 Help Entry 101079899         CDS       T02386                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism tru  Takifugu rubripes (torafugu) Pathway tru04010   MAPK signaling pathway tru04012   ErbB signaling pathway tru04068   FoxO signaling pathway tru04137   Mitophagy - animal tru04140   Autophagy - animal tru04144   Endocytosis tru04150   mTOR signaling pathway tru04210   Apoptosis tru04218   Cellular senescence tru04370   VEGF signaling pathway tru04371   Apelin signaling pathway tru04510   Focal adhesion tru04540   Gap junction tru04625   C-type lectin receptor signaling pathway tru04810   Regulation of actin cytoskeleton tru04910   Insulin signaling pathway tru04912   GnRH signaling pathway tru04916   Melanogenesis tru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101079899 (hras)    04012 ErbB signaling pathway     101079899 (hras)    04370 VEGF signaling pathway     101079899 (hras)    04371 Apelin signaling pathway     101079899 (hras)    04068 FoxO signaling pathway     101079899 (hras)    04150 mTOR signaling pathway     101079899 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101079899 (hras)    04140 Autophagy - animal     101079899 (hras)    04137 Mitophagy - animal     101079899 (hras)   09143 Cell growth and death    04210 Apoptosis     101079899 (hras)    04218 Cellular senescence     101079899 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101079899 (hras)    04540 Gap junction     101079899 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101079899 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101079899 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     101079899 (hras)    04912 GnRH signaling pathway     101079899 (hras)    04916 Melanogenesis     101079899 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101079899 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tru04131]     101079899 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tru04147]     101079899 (hras)    04031 GTP-binding proteins [BR:tru04031]     101079899 (hras) Membrane trafficking [BR:tru04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101079899 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     101079899 (hras) Exosome [BR:tru04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101079899 (hras)   Exosomal proteins of colorectal cancer cells    101079899 (hras) GTP-binding proteins [BR:tru04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101079899 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  101079899 NCBI-ProteinID:  XP_003967415 Ensembl:  ENSTRUG00000024825 UniProt:  A0A3B5KFE1 LinkDB All DBs Position 9:8231417..8242953 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTKQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtagtgggagctggtggcgtgggcaagagcgcgctcacc atccagctcatccaaaaccactttgtggatgaatatgaccccaccatagaggactcctac agaaagcaggttgtgattgatggggagacctgtctgctggacatcttggacactgcaggt caagaggagtacagcgccatgagggaccagtacatgaggacgggggagggcttcctctgt gtctttgccatcaacaacaccaagtcatttgaggacatccaccagtacagagaacagatt aaacgcgtgaaagactcggacgacgtcccgatggtgctggtcggaaacaaatgtgacctc ccggcacgcaccgtggacacaaagcaagcccaggaactagcccggtcctatggtatcccc ttcatcgagacctctgccaaaacacgacagggagtagaagatgccttctacacactggtc agggagatcaggcagcataaactgaggaagttgaacccccctgatgagagcggtcaggac tgcatgagctgtcgctgcgtcgtatcatga

DBGET integrated database retrieval system