Takifugu rubripes (torafugu): 105418180 Help Entry 105418180         CDS       T02386                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism tru  Takifugu rubripes (torafugu) Pathway tru04060   Cytokine-cytokine receptor interaction tru04218   Cellular senescence tru04620   Toll-like receptor signaling pathway tru04621   NOD-like receptor signaling pathway tru04622   RIG-I-like receptor signaling pathway tru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105418180  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     105418180  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105418180    04621 NOD-like receptor signaling pathway     105418180    04622 RIG-I-like receptor signaling pathway     105418180  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105418180  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tru04052]     105418180    00536 Glycosaminoglycan binding proteins [BR:tru00536]     105418180 Cytokines and neuropeptides [BR:tru04052]  Cytokines   Chemokines    105418180 Glycosaminoglycan binding proteins [BR:tru00536]  Heparan sulfate / Heparin   Chemokines    105418180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Gp_UL130 Motif Other DBs NCBI-GeneID:  105418180 NCBI-ProteinID:  XP_029696910 UniProt:  A0A674PMW3 LinkDB All DBs Position 8:complement(14067872..14069179) Genome browser AA seq 103 aa AA seqDB search MKLCILLVFATMLAVITGMPPISRDYNNRCRCLQVESRIIPPDNLKSIKLITEGPHCPEK EVIANLVNGAKVCLNPKSTWVKKLVHFVLGKQLSRKQATLPKA NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcctcctcgtgttcgccaccatgctggctgtcatcactggaatgcca ccgatcagcagggactacaacaaccgctgccgctgcctgcaggtggagtccaggatcatc cctcccgacaacctgaagagcatcaagctcatcacagaagggccccactgtcccgagaag gaagtcatagctaacttggtgaacggagccaaggtttgcctcaaccccaagtccacctgg gtgaagaaactggtccattttgttcttgggaaacagctcagtcggaagcaagcaacactg cctaaggcctga

DBGET integrated database retrieval system