Takifugu rubripes (torafugu): 115250254 Help Entry 115250254         CDS       T02386                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism tru  Takifugu rubripes (torafugu) Pathway tru04115   p53 signaling pathway tru04137   Mitophagy - animal tru04140   Autophagy - animal tru04210   Apoptosis tru04621   NOD-like receptor signaling pathway tru05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tru00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115250254    04137 Mitophagy - animal     115250254   09143 Cell growth and death    04210 Apoptosis     115250254    04115 p53 signaling pathway     115250254  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     115250254  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     115250254  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tru01009]     115250254   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tru03036]     115250254   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tru02000]     115250254 Protein phosphatases and associated proteins [BR:tru01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      115250254 Chromosome and associated proteins [BR:tru03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     115250254 Transporters [BR:tru02000]  Other transporters   Pores ion channels [TC:1]    115250254 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 TraD Bcl-2_3 BH4 Motif Other DBs NCBI-GeneID:  115250254 NCBI-ProteinID:  XP_029693977 LinkDB All DBs Position 6:complement(2609373..2610580) Genome browser AA seq 191 aa AA seqDB search MSNRELVENCLIYKLSQKYPGTVSPPAGTGREALNAALRSMANKYERDFMEQAGDLSPYV AVTRNKAGFNKVMDDMFRDEINWGTVVGLFVVGGATYVQSFEGGASEPVCHVADWMTDYL DQRINPWIESQGGWDCFVTIYGEDACTNRAQEDRRKWILGGLVVLAGVLIIVTKNYGTLR KAFSNFMSYWS NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgtctaatagagagctggtagagaactgtttaatctacaaactctctcagaaataccca ggcactgtgtctccacccgcaggtactggcagagaggctttgaatgcagctcttcggagc atggcaaataagtacgagcgggactttatggagcaagcgggtgacctctccccatacgtc gccgtgactaggaacaaggcaggttttaacaaggtgatggacgacatgttcagagatgaa atcaactggggaacagttgtaggtctttttgtcgtgggcggcgccacttatgtgcaatct ttcgagggcggcgcaagtgaaccggtttgccacgttgcagactggatgacagattacctg gaccaacggattaatccatggatcgagagtcaaggaggatgggactgctttgttaccatt tatggggaagacgcctgcacaaacagagctcaggaagacaggcgtaaatggatactgggc ggactggtggtgctggctggtgttttgatcattgttacaaaaaattatggtacattgcgt aaggcattttcaaactttatgtcttattggtcatag

DBGET integrated database retrieval system