Takifugu rubripes (torafugu): 445923 Help Entry 445923            CDS       T02386                                  Symbol il8 Name (RefSeq) interleukin 8 precursor   KO K10030   interleukin 8 Organism tru  Takifugu rubripes (torafugu) Pathway tru04060   Cytokine-cytokine receptor interaction tru04218   Cellular senescence tru04620   Toll-like receptor signaling pathway tru04621   NOD-like receptor signaling pathway tru04622   RIG-I-like receptor signaling pathway tru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tru00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     445923 (il8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     445923 (il8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     445923 (il8)    04621 NOD-like receptor signaling pathway     445923 (il8)    04622 RIG-I-like receptor signaling pathway     445923 (il8)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     445923 (il8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tru04052]     445923 (il8)    00536 Glycosaminoglycan binding proteins [BR:tru00536]     445923 (il8) Cytokines and neuropeptides [BR:tru04052]  Cytokines   Chemokines    445923 (il8) Glycosaminoglycan binding proteins [BR:tru00536]  Heparan sulfate / Heparin   Chemokines    445923 (il8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  445923 NCBI-ProteinID:  NP_001027759 Ensembl:  ENSTRUG00000006788 UniProt:  Q6F4N2 LinkDB All DBs Position 17:complement(6199120..6200211) Genome browser AA seq 98 aa AA seqDB search MCSRVFLTSLVVLLAFLAISNGMSLRSLGVEQHCRCIQTESRPIGRHIGKVELIPPNSHC EETEIIATLKMSGQEVCLDPKAPWVKKVINKIMSSRQR NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtgcagcagagtcttcctcacatctctcgtggtgctcctggcattcctggctatcagc aatggaatgagcctgcggagcctcggagtggaacagcactgccgctgcatccagacagag agtcggcccatcggccgccacattggcaaggtggagctgattccccccaactcccactgt gaagagacagagatcattgccactctgaagatgtcagggcaagaagtttgcctggatcct aaagctccctgggtgaagaaggtcatcaacaagatcatgtccagcagacaacgctga

DBGET integrated database retrieval system