Tropicibacter oceani: QF118_01550 Help Entry QF118_01550       CDS       T09169                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism try  Tropicibacter oceani Pathway try00190   Oxidative phosphorylation try01100   Metabolic pathways Module try_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:try00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     QF118_01550  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:try00194]     QF118_01550 Photosynthesis proteins [BR:try00194]  Photosystem and electron transport system   F-type ATPase [OT]    QF118_01550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WGW04249 LinkDB All DBs Position complement(310771..310995) Genome browser AA seq 74 aa AA seqDB search MEGDLAHIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALG IFAFLVSLLLMFAV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgatctcgcacacatcggcgcaggcctggcagcaatcggttccggcgcagcc gcaatcggggttggcaacgttgcaggcaacttccttgccggcgcactgcgcaacccctcg gcagctgcttcgcagacggccaccctgttcatcggcatcgcattcgcagaagcgctgggc atcttcgccttcctcgtttcgctgctgctgatgttcgccgtctaa

DBGET integrated database retrieval system