Tropicibacter oceani: QF118_19430 Help Entry QF118_19430       CDS       T09169                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism try  Tropicibacter oceani Pathway try01100   Metabolic pathways try01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:try00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QF118_19430    00074 Mycolic acid biosynthesis     QF118_19430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QF118_19430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Phage_DsbA Motif Other DBs NCBI-ProteinID:  WGW06022 LinkDB All DBs Position unnamed2:8784..9017 Genome browser AA seq 77 aa AA seqDB search MTALLSEELHRIAPDIDLTDIDRSEDLRDELDIDSMDFLRLVTALGKRLNLDMPEADYDR MRSFDAMLSYLQARGAG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaccgccctcctgagcgaagaactgcaccgcatcgcccccgatatcgacctgaccgac atcgaccgatccgaagacctgcgcgacgaattggacattgattcgatggatttcctgcgg ctggtgacggcgctgggaaaacgcctgaaccttgacatgcccgaggcggattatgaccgg atgcgcagctttgacgcgatgctgtcctatctgcaggcgcggggggcggggtga

DBGET integrated database retrieval system