KEGG   Treponema vincentii: GWP43_01590
Entry
GWP43_01590       CDS       T06435                                 
Name
(GenBank) RnfABCDGE type electron transport complex subunit B
  KO
K03616  H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2]
Organism
trz  Treponema vincentii
Brite
KEGG Orthology (KO) [BR:trz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GWP43_01590
Enzymes [BR:trz01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)
     GWP43_01590
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)
     GWP43_01590
SSDB
Motif
Pfam: Fer4 Fer4_7 FeS Fer4_6 Fer4_21 Fer4_9 Fer4_2 Fer4_10 Fer4_4 Fer4_16 Fer4_8 Fer4_15 Fer4_17 Fer4_3
Other DBs
NCBI-ProteinID: QHX42355
UniProt: A0A6P1XYG2
LinkDB
Position
349977..350819
AA seq 280 aa
MQIIILTLIVSLILSLAIGFLLGFFKKLFYVAPDETVAKIREVLPGANCGACGFPGCDGF
AAAVASGNAPVNGCSVGAGPVAAKVGAIMGVSANADAKVAVLLCQGSHDVCKEKADYVGV
KTCRAAKISVNGLRECDWGCIGLGDCEMACPFDAIHVEADGIPHVDYEKCTGCAVCVAAC
PQHILTTVPTSRKGSIALCSCRNPKKAVIMKNCKRGCIKCMKCEKNCPTGAIKVINGIPE
VNYELCDSCGICIKGCPTKVLALVEDKIAVLSPCSACEAC
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcaaataattattttaacgcttatcgtttcgctgattttatcgttagcgataggcttt
ttattaggcttttttaaaaagctgttttatgtagcacctgatgaaacggttgcgaaaatc
cgtgaggtgcttcccggtgcaaactgcggtgcgtgcggttttccgggctgtgacggtttt
gcggctgcggttgcaagcggcaatgcgccggtaaacggctgttccgtcggtgccggtccc
gttgcggcgaaagtcggtgcgattatgggcgtttcggcaaatgccgatgcaaaagtcgca
gttctgctttgccaaggttcgcacgatgtctgcaaagaaaaggcggattatgtcggcgtt
aaaacatgtcgcgccgcaaagatttcagtcaacggactgcgggaatgcgattggggctgt
atcggcctcggcgactgcgaaatggcctgtccgtttgatgccatccatgttgaagcggac
ggtattcctcatgtcgattatgaaaaatgtaccggctgcgcagtatgtgttgcggcctgt
cctcagcatattttgaccacggtacctacctcgcggaaaggttccattgcgctttgttca
tgcagaaatccgaaaaaagcagttatcatgaaaaactgcaagcgcggctgtatcaagtgt
atgaagtgcgaaaagaactgcccaaccggtgcgatcaaagttattaacggtattccggaa
gtgaattacgagctctgcgattcctgcggtatctgtataaagggctgcccgacaaaggtg
ctcgctttagtagaagataagattgcagtgctgtcgccctgcagcgcgtgcgaagcgtgt
taa

DBGET integrated database retrieval system