Terriglobus saanensis: AciPR4_2391 Help Entry AciPR4_2391       CDS       T01408                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism tsa  Terriglobus saanensis Pathway tsa03030   DNA replication tsa03430   Mismatch repair tsa03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tsa00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     AciPR4_2391    03430 Mismatch repair     AciPR4_2391    03440 Homologous recombination     AciPR4_2391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tsa03032]     AciPR4_2391    03400 DNA repair and recombination proteins [BR:tsa03400]     AciPR4_2391    03029 Mitochondrial biogenesis [BR:tsa03029]     AciPR4_2391 DNA replication proteins [BR:tsa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AciPR4_2391 DNA repair and recombination proteins [BR:tsa03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      AciPR4_2391   TLS (translesion DNA synthesis) factors    Other SOS response factors     AciPR4_2391 Mitochondrial biogenesis [BR:tsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     AciPR4_2391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon DUF1980_C Motif Other DBs NCBI-ProteinID:  ADV83171 UniProt:  E8UYL8 LinkDB All DBs Position complement(2906826..2907197) Genome browser AA seq 123 aa AA seqDB search MYLNKAILMGFLGGDAVVRTGKNNKPFTTLSLATKESYKDKETGKYNERTEWHNLIVFGK LAEFAGKLKKGAHIQIEGKIQHSEYKGVQTDTIRVTSILKLDRAERVAAEEEFDEITEED VAA NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtacctgaacaaagcaatcctcatgggcttcctcggcggcgatgcagtcgttcgcacc ggcaaaaacaacaaaccgttcaccacgctttcccttgcaaccaaggagtcctataaggac aaagagaccggcaagtacaacgagcgcaccgagtggcataacctcatcgtcttcggcaag ctggccgagttcgcaggcaagctcaagaagggcgctcacatccaaatcgagggcaagatt cagcactcggaatacaagggcgtgcagaccgacacgatccgggtgacttccatcctcaag ctcgaccgcgcagagcgggttgccgccgaggaagagttcgatgagatcactgaagaggac gtggccgcatag

DBGET integrated database retrieval system