Thiothrix subterranea: HMY34_02555
Help
Entry
HMY34_02555 CDS
T07831
Name
(GenBank) aspartate kinase
KO
K00928
aspartate kinase [EC:
2.7.2.4
]
Organism
tsb
Thiothrix subterranea
Pathway
tsb00260
Glycine, serine and threonine metabolism
tsb00261
Monobactam biosynthesis
tsb00270
Cysteine and methionine metabolism
tsb00300
Lysine biosynthesis
tsb01100
Metabolic pathways
tsb01110
Biosynthesis of secondary metabolites
tsb01120
Microbial metabolism in diverse environments
tsb01210
2-Oxocarboxylic acid metabolism
tsb01230
Biosynthesis of amino acids
Module
tsb_M00016
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
tsb_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
tsb00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
HMY34_02555
00270 Cysteine and methionine metabolism
HMY34_02555
00300 Lysine biosynthesis
HMY34_02555
09110 Biosynthesis of other secondary metabolites
00261 Monobactam biosynthesis
HMY34_02555
Enzymes [BR:
tsb01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.2 Phosphotransferases with a carboxy group as acceptor
2.7.2.4 aspartate kinase
HMY34_02555
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AA_kinase
ACT_9
ACT_7
ACT
DUF3335
Motif
Other DBs
NCBI-ProteinID:
QQZ27722
LinkDB
All DBs
Position
complement(522202..523434)
Genome browser
AA seq
410 aa
AA seq
DB search
MALIVQKYGGTSVGTPERIEAVADRVIRWKQQGNDVIVVVSAMSGETNKLVALINAINPQ
GSEREKDAILSTGEQVTIGLLAMALEKKGQPARSYTGAQVRILTDDAYTKARIRDIDAEP
IRKDLAEGKVVVVAGFQGVTEDGSITTLGRGGSDTTGVALAVALKADECQIYTDVDGVYT
TDPRVEPKARHIPRLTLEEMLEMASQGSKVLQIRSVEFAYKYDMPIRVLSSFDEFGQGKS
TLVTREEEVMEEVSVRGIAFNRDEAQLTVTGVPDRPGVAYQILGPISDANIEVDMIVQNI
GSDGSTDFTFTVHKNDYAKARDILCKTGETLGAKQCTGDENIAKVAIVGAGMRSHAGVAS
KMFKTLADEGINIRMISTSEIKVAVVVDEKYLELAVRVLHQAFGLAQTAA
NT seq
1233 nt
NT seq
+upstream
nt +downstream
nt
atggcactgatcgtacagaaatacggcggtacatcggttggcacacctgagcgtattgag
gctgtggctgaccgggtaatccgctggaaacaacagggcaatgatgtgatcgtggtggtt
tccgcgatgtcgggtgaaaccaataaactggtcgcgctcatcaacgccattaacccacaa
ggttcggagcgcgaaaaagacgcgattctgtccaccggcgaacaagtcacgattggcttg
ctggcaatggcgttggaaaagaaaggccagcctgcgcgttcttacaccggggcgcaggta
cgcatcttgactgatgatgcttataccaaagcgcggattcgcgacattgacgccgagcca
atccgtaaagatttggcggaaggcaaagtggtggtggtagcaggtttccaaggtgtgacc
gaagatggcagcattaccaccttagggcgcggcggttcggataccacgggcgtggctttg
gcagtggcattaaaagctgacgaatgccagatttacaccgacgtggatggcgtttacacc
accgacccgcgtgtcgaacccaaagcgcgtcacattccgcgcctgaccttggaagaaatg
ctggaaatggccagccaaggctccaaggtgctgcaaattcgttcggttgaatttgcctac
aaatatgatatgcctatccgcgtgctctccagctttgacgaatttggtcagggcaaaagc
acgctggtcactcgtgaggaagaagtaatggaagaagtctcagtccgtgggattgcgttc
aatcgtgatgaagctcaattgacggtaacgggtgtacccgatcgccccggtgttgcttac
cagattctggggccgatttcggatgccaatatcgaagtcgatatgattgtgcaaaacatt
ggttctgatggttcgaccgatttcaccttcacggtacacaaaaacgattacgccaaagcg
cgtgacattctgtgtaaaaccggcgaaaccttgggcgcaaagcaatgcacaggcgatgaa
aatattgccaaggtagccattgtgggcgcaggaatgcgttctcatgcgggcgttgccagc
aaaatgttcaaaacattggcagacgagggcattaatatccgcatgatttccacgtcggaa
attaaagtggcggtcgttgtcgatgagaaatatttggaactcgctgtgcgggtgttgcat
caagcgtttggcttagcgcaaacagccgcttaa
DBGET
integrated database retrieval system