Thiothrix subterranea: HMY34_05150 Help Entry HMY34_05150       CDS       T07831                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tsb  Thiothrix subterranea Brite KEGG Orthology (KO) [BR:tsb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsb03036]     HMY34_05150 (ftsL) Chromosome and associated proteins [BR:tsb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HMY34_05150 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL FtsL_2 APG6_N FBF1 DivIC DEDD_Tnp_IS110 YabA Motif Other DBs NCBI-ProteinID:  QQZ28191 LinkDB All DBs Position complement(1082528..1082800) Genome browser AA seq 90 aa AA seqDB search MNRSGLLRVALLYFLVIALALMIVVNRHHSRQLFAELQKLEKERDELSADWSRLKLEQST LLNQVHVETRSKQVLKMQKPSADNIKVIRE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaatagaagcggcttgctgcgtgtggcgttactgtattttttggtgattgctttggcg ctgatgattgtagtgaatcggcatcattcgcgccaattgtttgccgaattgcaaaaattg gaaaaagaacgcgatgaactgagcgctgattggagccgcttgaaattggaacaaagcacc ttgttaaatcaggtacacgtggaaacccgttctaaacaggtattaaaaatgcagaaaccc agtgctgataatattaaggtgattcgcgagtga

DBGET integrated database retrieval system