Thermus scotoductus: TSC_c05840 Help Entry TSC_c05840        CDS       T01414                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tsc  Thermus scotoductus Pathway tsc01100   Metabolic pathways tsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TSC_c05840 (acpP)    00074 Mycolic acid biosynthesis     TSC_c05840 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TSC_c05840 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADW21216 UniProt:  E8PM61 LinkDB All DBs Position complement(537624..537866) Genome browser AA seq 80 aa AA seqDB search MTEQEIFEKVKAVIADKLSVEPEKITLEARFIEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVAYIQAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggagcaggagatctttgaaaaggtgaaggcggttattgcggacaagctctcggtg gaacccgagaagatcaccctcgaggcccgcttcatcgaggacctgggggcggacagcctg gataccgtggagctcatcatgggcctcgaggacgagttcggcctggaaatctccgacgag gaggccgaaaagatccgcaccgtgaaggatgcggtggcctacatccaggccaagctaggc tag

DBGET integrated database retrieval system