Thermus scotoductus: TSC_c10080 Help Entry TSC_c10080        CDS       T01414                                  Name (GenBank) conserved domain protein   KO K03116   sec-independent protein translocase protein TatA Organism tsc  Thermus scotoductus Pathway tsc03060   Protein export tsc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tsc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TSC_c10080  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     TSC_c10080  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tsc02044]     TSC_c10080 Secretion system [BR:tsc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    TSC_c10080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ADW21633 UniProt:  E8PPG7 LinkDB All DBs Position complement(958181..958330) Genome browser AA seq 49 aa AA seqDB search MEILLILLVILLLFGAKKLPELARGIGQSAKEFKKGLQEGEEKKEEPKA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt gtggaaatcctcctcatccttctcgtcatcctcctcctcttcggcgccaagaagcttccc gagctggcccggggcattggccagtcggccaaggagttcaaaaagggcctccaggaaggc gaggagaagaaggaagagcctaaggcctga

DBGET integrated database retrieval system