Thermus scotoductus: TSC_c20300 Help Entry TSC_c20300        CDS       T01414                                  Name (GenBank) conserved domain protein   KO K18997   chaperone modulatory protein CbpM Organism tsc  Thermus scotoductus Brite KEGG Orthology (KO) [BR:tsc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsc03036]     TSC_c20300 Chromosome and associated proteins [BR:tsc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     TSC_c20300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MerR_2 MerR_1 HTH_17 Motif Other DBs NCBI-ProteinID:  ADW22636 UniProt:  E8PNA2 LinkDB All DBs Position 1924523..1924759 Genome browser AA seq 78 aa AA seqDB search MLARSSYLSLEALADYGLSLGVVRAYVEIGFVEPLEVGGAWYFREEDLLRMAKAERIRRD LGANLVGAALVVEILERR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgctcgcgcgtagctcctacctatccctggaagccctggcggactacggcctctccctg ggggtggtgcgggcctacgtggagatcggcttcgtggagcccctcgaggtggggggtgcc tggtacttccgggaggaagaccttctgcgcatggccaaggcggaacgcatccgccgcgac ctgggggccaacctggtgggggcagccttggtggtggagatcctggagcgccgctaa

DBGET integrated database retrieval system