Thermus scotoductus: TSC_c22890 Help Entry TSC_c22890        CDS       T01414                                  Name (GenBank) conserved domain protein   KO K03116   sec-independent protein translocase protein TatA Organism tsc  Thermus scotoductus Pathway tsc03060   Protein export tsc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tsc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TSC_c22890  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     TSC_c22890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tsc02044]     TSC_c22890 Secretion system [BR:tsc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    TSC_c22890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ADW22891 UniProt:  E8PPP3 LinkDB All DBs Position complement(2150133..2150408) Genome browser AA seq 91 aa AA seqDB search MNLGMPEILVILVVALLIFGPKKLPELGRSLGQSIREFKRGAQEIREELEKSVDVREEKG PEGARLAREKPVSEASSKAPEVSEPQEERKA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacctgggcatgccggaaatcctggtgatcctggtggtggccctcctcatcttcggg cccaagaaactccccgagctcggccgttccctgggccagagcatccgggagttcaagcgg ggggcccaggagatccgggaggagctggagaagagcgtggacgtgcgggaggaaaagggc cccgaaggggctaggttggctagggagaagccggtttccgaggcttcctccaaggcccct gaggtttccgaaccccaagaggagcgtaaggcttga

DBGET integrated database retrieval system