Tritonibacter scottomollicae: R1T40_05815 Help Entry R1T40_05815       CDS       T09466                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tsco  Tritonibacter scottomollicae Pathway tsco01100   Metabolic pathways tsco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R1T40_05815    00074 Mycolic acid biosynthesis     R1T40_05815   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R1T40_05815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WOI34245 UniProt:  A0ABZ0HJ96 LinkDB All DBs Position complement(1104006..1104266) Genome browser AA seq 86 aa AA seqDB search MSTQDKVIAIIAEQAVLEPSDVTLDGTLEDLGIDSLGLVESIFAIEEEFDITIPFNANEP ERSDFDISNVAAIIAGIDKLVAEKNG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcacgcaggataaggtcatcgcaatcatcgctgagcaggcggtattggagccctcg gatgtaaccctcgacggcacgctggaagatctcggcatcgacagccttggcctcgttgaa agcatctttgcgatcgaagaagaattcgacattaccatccccttcaacgccaacgagcct gagcggagcgatttcgatatctcgaatgtcgccgccatcatcgccgggatcgacaaactg gtcgccgaaaagaacggctga

DBGET integrated database retrieval system