Thiosulfatimonas sediminis: THMIRHAS_06390 Help Entry THMIRHAS_06390    CDS       T06859                                  Name (GenBank) hypothetical protein   KO K08679   UDP-glucuronate 4-epimerase [EC:5.1.3.6] Organism tse  Thiosulfatimonas sediminis Pathway tse00053   Ascorbate and aldarate metabolism tse00520   Amino sugar and nucleotide sugar metabolism tse01100   Metabolic pathways tse01240   Biosynthesis of cofactors tse01250   Biosynthesis of nucleotide sugars Module tse_M00999   UDP-GlcA/GalA biosynthesis, UDP-Glc => UDP-GlcA => UDP-GalA Brite KEGG Orthology (KO) [BR:tse00001]  09100 Metabolism   09101 Carbohydrate metabolism    00053 Ascorbate and aldarate metabolism     THMIRHAS_06390   09107 Glycan biosynthesis and metabolism    00520 Amino sugar and nucleotide sugar metabolism     THMIRHAS_06390 Enzymes [BR:tse01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.3  Acting on carbohydrates and derivatives     5.1.3.6  UDP-glucuronate 4-epimerase      THMIRHAS_06390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  BBP45266 UniProt:  A0A6F8PT49 LinkDB All DBs Position 706176..706424 Genome browser AA seq 82 aa AA seqDB search MINCVAHHIVSYVLCLNALIKGVCGKKAKENLMPMQAGDVPITYADVDDLIADTGFKPST SIEDGIGNFVEWYKKYYKLAKK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgattaattgtgttgcgcaccacattgttagttacgtgctttgcctaaacgccctcatt aaaggcgtgtgtggcaaaaaagccaaagaaaatctgatgcccatgcaagccggtgacgtg ccgattacctatgccgatgtggatgatcttattgccgatacgggttttaaaccaagcacc agtattgaagacgggattggaaacttcgttgagtggtataagaaatactataaattggcg aaaaaatga

DBGET integrated database retrieval system